Command the Multifunctional Signal of Homeostasis. VIP is not a single-target neurotransmitter; it is a 28-amino acid neuropeptide that acts as a primary neurotransmitter, neuromodulator, and potent vasodilator across the central nervous system and peripheral tissues. By binding to VPAC1 and VPAC2 receptors, it serves as a master regulator of neuroprotection, circadian rhythms, smooth muscle relaxation, and immune modulation. For neuroscientists, immunologists, and pulmonary researchers, VIP provides a critical key to understanding integrative physiology and cellular resilience. 🧬
Imagine a Single Molecule Orchestrating Brain Protection, Airway Relaxation, and Immune Balance. VIP's exceptionally broad research profile stems from its role as a pleiotropic signaling hub:
Neurological System: Functions as a key neuroprotective agent, supporting neuronal survival, synaptic plasticity, and cerebral blood flow; central to research on Alzheimer's, Parkinson's, and circadian sleep disorders.
Pulmonary & Cardiovascular Systems: Acts as a potent bronchodilator and vasodilator, relevant for studying asthma, pulmonary hypertension, and vascular function.
Immune System: Modulates inflammatory responses, shifting macrophages to an anti-inflammatory (M2) phenotype and regulating T-cell activity.
Digestive System: Influences gastrointestinal motility and secretion.
This makes it a uniquely versatile tool for investigating neuroinflammatory diseases, autoimmune conditions, respiratory disorders, and the neuro-immune axis.
Researching a Ubiquitous Regulator Demands Uncompromising Purity. Working with a peptide of such widespread physiological importance requires molecular precision.
High Bio-Identical Purity: ≥97% synthetic peptide, with the human sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ verified by HPLC and Mass Spectrometry. ✅
Complete Analytical Verification: Full batch-specific Certificate of Analysis (CoA) confirming identity, purity, and peptide content for reproducible research. 📄
Stability for Complex Models: Lyophilized under stringent conditions to preserve its integrity for sensitive in-vitro and in-vivo studies. ⚙️
Your Partner in Complex Systems Biology.
Decoding the multifaceted roles of VIP requires a partner with a systems-level understanding. We provide detailed mechanistic literature, application guidance across different biological systems, and reliable supply for your interdisciplinary research. Partner with us to explore the master signal of homeostasis and resilience. 🚀
Technical Specifications:
Sequence: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂
CAS: 37221-79-7
Appearance: White lyophilized powder
Core Research Value: The definitive pleiotropic neuropeptide for research in neuroprotection, immunomodulation, smooth muscle relaxation, and systemic homeostasis. 🎯
ZhuoShang Biotechnology Co., Ltd.
Add: Building 2, Chuangzhi 863 Plaza Luolong District Henan China
Tel: +852 63511267
Email: [email protected]